PDB entry 6f83

View 6f83 on RCSB PDB site
Description: Crystal Structure of Human Galectin-1 in Complex With Thienyl-1,2, 3-triazolyl Thiodigalactoside Inhibitor
Class: sugar binding protein
Keywords: carbohydrate-recognition, beta sandwich, carbohydrate binding protein, sugar binding protein
Deposited on 2017-12-12, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f83a_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6f83b_
  • Heterogens: 5KT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6f83A (A:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6f83B (B:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd