SCOPe 2.08: Domain d6f83b_: 6f83 B:

Lineage for d6f83b_ (6f83 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
   Uniprot P09382

8. Domain d6f83b_: 6f83 B: [363167]
   automated match to d1gzwa_
   complexed with 5kt

Details for d6f83b_

PDB Entry: 6f83, 2.2 Å

PDB Description: crystal structure of human galectin-1 in complex with thienyl-1,2, 3- triazolyl thiodigalactoside inhibitor

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d6f83b_:

Sequence; same for both SEQRES and ATOM records:

>d6f83b_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

Timeline for d6f83b_:

• d6f83b_ first appeared in SCOPe 2.07