SCOPe 2.07: Structural Classification of Proteins

PDB entry 6ezj

View 6ezj on RCSB PDB site
Description: Imidazoleglycerol-phosphate dehydratase
Class: lyase
Keywords: Inhibitor, histidine biosynthesis, lyase, complex
Deposited on 2017-11-15, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezja1, d6ezja2
Chain 'B':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjb1, d6ezjb2
Chain 'C':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjc1, d6ezjc2
Chain 'D':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjd1, d6ezjd2
Chain 'E':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezje1, d6ezje2
Chain 'F':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjf1, d6ezjf2
Chain 'G':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjg1, d6ezjg2
Chain 'H':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjh1, d6ezjh2
Chain 'I':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezji1, d6ezji2
Chain 'J':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjj1, d6ezjj2
Chain 'K':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjk1, d6ezjk2
Chain 'L':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjl1, d6ezjl2
Chain 'M':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjm1, d6ezjm2
Chain 'N':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjn1, d6ezjn2
Chain 'O':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjo1, d6ezjo2
Chain 'P':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjp1, d6ezjp2
Chain 'Q':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjq1, d6ezjq2
Chain 'R':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjr1, d6ezjr2
Chain 'S':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjs1, d6ezjs2
Chain 'T':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjt1, d6ezjt2
Chain 'U':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezju1, d6ezju2
Chain 'V':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjv1, d6ezjv2
Chain 'W':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjw1, d6ezjw2
Chain 'X':
Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
Species: Arabidopsis thaliana [TaxId:3702]
Gene: HISN5B, At4g14910, dl3495c
Database cross-references and differences (RAF-indexed):
- Uniprot O23346
Domains in SCOPe 2.07: d6ezjx1, d6ezjx2
Heterogens: 5LD, MN

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6ezjA (A:)
maspiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhv
ratgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrp
ylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafara
lrqatesdprrggtipsskgvlsrs