PDB entry 6ehg

View 6ehg on RCSB PDB site
Description: complement component C3b in complex with a nanobody
Class: immune system
Keywords: Protein Complex, Inhibitor, Complement, Complement System, single domain antibody, nanobody, IMMUNE SYSTEM
Deposited on 2017-09-13, released 2018-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Complement C3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (0-642)
    • conflict (372)
    • conflict (408)
• Chain 'B':
  Compound: Complement C3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01024 (Start-914)
    • conflict (264)
    • conflict (631)
• Chain 'C':
  Compound: hC3Nb1
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 6EHG
  Domains in SCOPe 2.08: d6ehgc1, d6ehgc2
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6ehgC (C:)
  mqvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrty
  yadsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqv
  tvsshhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ehgC (C:)
  qvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrtyy
  adsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqvt
  vssh