PDB entry 6ehg

View 6ehg on RCSB PDB site
Description: complement component C3b in complex with a nanobody
Class: immune system
Keywords: Protein Complex, Inhibitor, Complement, Complement System, single domain antibody, nanobody, IMMUNE SYSTEM
Deposited on 2017-09-13, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01024 (0-642)
      • conflict (372)
      • conflict (408)
  • Chain 'B':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01024 (Start-914)
      • conflict (264)
      • conflict (631)
  • Chain 'C':
    Compound: hC3Nb1
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EHG
    Domains in SCOPe 2.07: d6ehgc1, d6ehgc2
  • Heterogens: NAG, BMA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ehgC (C:)
    mqvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrty
    yadsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ehgC (C:)
    qvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrtyy
    adsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqvt
    vssh