Lineage for d6ehgc1 (6ehg C:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743951Domain d6ehgc1: 6ehg C:1-121 [350326]
    Other proteins in same PDB: d6ehgc2
    automated match to d5j1sc_
    complexed with nag

Details for d6ehgc1

PDB Entry: 6ehg (more details), 2.65 Å

PDB Description: complement component c3b in complex with a nanobody
PDB Compounds: (C:) hC3Nb1

SCOPe Domain Sequences for d6ehgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ehgc1 b.1.1.1 (C:1-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrtyy
adsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqvt
v

SCOPe Domain Coordinates for d6ehgc1:

Click to download the PDB-style file with coordinates for d6ehgc1.
(The format of our PDB-style files is described here.)

Timeline for d6ehgc1: