| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d6ehgc1: 6ehg C:1-121 [350326] Other proteins in same PDB: d6ehgc2 automated match to d5j1sc_ complexed with nag |
PDB Entry: 6ehg (more details), 2.65 Å
SCOPe Domain Sequences for d6ehgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ehgc1 b.1.1.1 (C:1-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvetggglvqaggslrlscaasgsifslnamgwfrqapgkerefvatinrsggrtyy
adsvkgrftisrdngknmvylqmhslkpedtaiyycaagtgwspqtdneynywgqgtqvt
v
Timeline for d6ehgc1: