PDB entry 6edg

View 6edg on RCSB PDB site
Description: Pseudomonas exotoxin A domain III T18H477L
Class: transferase
Keywords: transferase
Deposited on 2018-08-09, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exotoxin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: CGU42_27545
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A222DLT0 (0-212)
      • engineered mutation (32)
      • engineered mutation (48)
      • engineered mutation (99)
      • engineered mutation (110)
      • engineered mutation (157)
    Domains in SCOPe 2.08: d6edga_
  • Heterogens: P34, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6edgA (A:)
ptgaeflgdggdvsfstrgtqnwtverllqahaqleergyvfvgyhgtaleaaqsivfgg
vrarsqdldaiwrgfyiagdpalaygyaqdqepdargriangallrvyvphsslpgfyrt
sltlaapeaageverlighplplrldaitgpeeeggreetilgwplaertvvipsaiptd
prnvggdldpssipdkeqaisalpdyasqpgkp