Lineage for d6edga_ (6edg A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558271Protein automated matches [190133] (6 species)
    not a true protein
  7. 2558337Species Pseudomonas aeruginosa [TaxId:287] [186856] (5 PDB entries)
  8. 3064345Domain d6edga_: 6edg A: [364407]
    automated match to d1dmaa_
    complexed with p34

Details for d6edga_

PDB Entry: 6edg (more details), 1.47 Å

PDB Description: pseudomonas exotoxin a domain iii t18h477l
PDB Compounds: (A:) Exotoxin

SCOPe Domain Sequences for d6edga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6edga_ d.166.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ptgaeflgdggdvsfstrgtqnwtverllqahaqleergyvfvgyhgtaleaaqsivfgg
vrarsqdldaiwrgfyiagdpalaygyaqdqepdargriangallrvyvphsslpgfyrt
sltlaapeaageverlighplplrldaitgpeeeggreetilgwplaertvvipsaiptd
prnvggdldpssipdkeqaisalpdyasqpgkp

SCOPe Domain Coordinates for d6edga_:

Click to download the PDB-style file with coordinates for d6edga_.
(The format of our PDB-style files is described here.)

Timeline for d6edga_: