PDB entry 6e71

View 6e71 on RCSB PDB site
Description: Structure of Human Transthyretin Val30Met/Thr119Met Mutant
Class: transport protein
Keywords: human transthyretin, amyloid, transthyretin, TRANSPORT PROTEIN
Deposited on 2018-07-25, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transthyretin
  Species: Homo sapiens [TaxId:9606]
  Gene: TTR, PALB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02766 (0-114)
    • engineered mutation (20)
    • engineered mutation (109)
  Domains in SCOPe 2.07: d6e71a_
• Chain 'B':
  Compound: Transthyretin
  Species: Homo sapiens [TaxId:9606]
  Gene: TTR, PALB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02766 (0-114)
    • engineered mutation (20)
    • engineered mutation (109)
  Domains in SCOPe 2.07: d6e71b_
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6e71A (A:)
  cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
  kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6e71B (B:)
  cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
  kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn