PDB entry 6e0g

View 6e0g on RCSB PDB site
Description: Mitochondrial peroxiredoxin from Leishmania infantum after heat stress without unfolding client protein
Class: chaperone
Keywords: heat-shock, client-binding, holdase, unfolding, CHAPERONE
Deposited on 2018-07-06, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: EM
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ga_
  • Chain 'B':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gb_
  • Chain 'C':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gc_
  • Chain 'D':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gd_
  • Chain 'E':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0ge_
  • Chain 'F':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gf_
  • Chain 'G':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gg_
  • Chain 'H':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gh_
  • Chain 'I':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gi_
  • Chain 'J':
    Compound: mitochondrial 2-cys-peroxiredoxin
    Species: Leishmania infantum [TaxId:5671]
    Gene: mTXNPx, LINJ_23_0050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6e0gj_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6e0gA (A:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gA (A:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6e0gB (B:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gB (B:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6e0gC (C:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gC (C:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6e0gD (D:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gD (D:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6e0gE (E:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gE (E:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6e0gF (F:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gF (F:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6e0gG (G:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gG (G:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6e0gH (H:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gH (H:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6e0gI (I:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gI (I:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6e0gJ (J:)
    mlrrlptscflkrsqfrgfaatspllnldyqmyrtatvreaapqfsgqavvngaikdinm
    ndykgkyivlffypmdftfvcpteiiafsdrhadfeklntqvvavscdsvyshlawvntp
    rkkgglgemhipvladksmeiardygvlieesgialrglfiidkkgilrhstindlpvgr
    nvdealrvleafqyadengdaipcgwkpgqptldttkageffeknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6e0gJ (J:)
    tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
    feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
    alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng