Lineage for d6e0gb_ (6e0g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879948Species Leishmania infantum [TaxId:5671] [365025] (1 PDB entry)
  8. 2879950Domain d6e0gb_: 6e0g B: [365030]
    automated match to d1qmva_

Details for d6e0gb_

PDB Entry: 6e0g (more details), 2.9 Å

PDB Description: mitochondrial peroxiredoxin from leishmania infantum after heat stress without unfolding client protein
PDB Compounds: (B:) mitochondrial 2-cys-peroxiredoxin

SCOPe Domain Sequences for d6e0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e0gb_ c.47.1.0 (B:) automated matches {Leishmania infantum [TaxId: 5671]}
tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad
feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi
alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng

SCOPe Domain Coordinates for d6e0gb_:

Click to download the PDB-style file with coordinates for d6e0gb_.
(The format of our PDB-style files is described here.)

Timeline for d6e0gb_: