Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Leishmania infantum [TaxId:5671] [365025] (1 PDB entry) |
Domain d6e0gb_: 6e0g B: [365030] automated match to d1qmva_ |
PDB Entry: 6e0g (more details), 2.9 Å
SCOPe Domain Sequences for d6e0gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e0gb_ c.47.1.0 (B:) automated matches {Leishmania infantum [TaxId: 5671]} tatvreaapqfsgqavvngaikdinmndykgkyivlffypmdftfvcpteiiafsdrhad feklntqvvavscdsvyshlawvntprkkgglgemhipvladksmeiardygvlieesgi alrglfiidkkgilrhstindlpvgrnvdealrvleafqyadeng
Timeline for d6e0gb_: