PDB entry 6d9p

View 6d9p on RCSB PDB site
Description: NMR solution structure of tamapin, mutant K27A
Class: toxin
Keywords: Tamapin mutant, K27A, CSalpha/beta, SK channels, TOXIN
Deposited on 2018-04-30, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potassium channel toxin alpha-KTx 5.4
  Species: Mesobuthus tamulus [TaxId:34647]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59869 (0-30)
    • engineered mutation (26)
  Domains in SCOPe 2.07: d6d9pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6d9pA (A:)
  afcnlrrcelscrslgllgkcigeecacvpy