PDB entry 6d3g

View 6d3g on RCSB PDB site
Description: PER-2 class A extended-spectrum beta-lactamase crystal structure in complex with avibactam at 2.4 Angstrom resolution
Class: hydrolase/hydrolase inhibitor
Keywords: DBO, penicilloil-serine-transferase, antibiotic resistance, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-04-16, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3ga_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3gb_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3gc_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: blaPER-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d3gd_
  • Heterogens: NXL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d3gA (A:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3gA (A:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkkls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d3gB (B:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3gB (B:)
    spllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelv
    ggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlset
    sqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpl
    lvavfvkdsaesertneaiiaqvaqaayqfelkklsavs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d3gC (C:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3gC (C:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkklsav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d3gD (D:)
    saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
    vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
    elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
    setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
    rpllvavfvkdsaesertneaiiaqvaqaayqfelkklsavspd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d3gD (D:)
    qspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhqvd
    qgkldlnqsvtvnraavntwspmmkdhqgdeftvavqqllqysvshsdnvacdllfelvg
    gpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkqlsets
    qallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdgrpll
    vavfvkdsaesertneaiiaqvaqaayqfelkkls