Lineage for d6d3ga_ (6d3g A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013606Species Citrobacter freundii [TaxId:546] [235913] (4 PDB entries)
  8. 3013611Domain d6d3ga_: 6d3g A: [368005]
    automated match to d3znwa_
    complexed with nxl, pg4

Details for d6d3ga_

PDB Entry: 6d3g (more details), 2.4 Å

PDB Description: per-2 class a extended-spectrum beta-lactamase crystal structure in complex with avibactam at 2.4 angstrom resolution
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6d3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d3ga_ e.3.1.1 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
saqspllkeqietivtgkkatvgvavwgpddleplllnpfekfpmqsvfklhlamlvlhq
vdqgkldlnqsvtvnraavlqntwspmmkdhqgdeftvavqqllqysvshsdnvacdllf
elvggpqalhayiqslgvkeaavvaneaqmhaddqvqyqnwtsmkaaaqvlqkfeqkkql
setsqallwkwmvetttgpqrlkgllpagtivahktgtsgvragktaatndagvimlpdg
rpllvavfvkdsaesertneaiiaqvaqaayqfelkkls

SCOPe Domain Coordinates for d6d3ga_:

Click to download the PDB-style file with coordinates for d6d3ga_.
(The format of our PDB-style files is described here.)

Timeline for d6d3ga_: