PDB entry 6cxk

View 6cxk on RCSB PDB site
Description: E. coli DHFR substrate complex with Dihydrofolate
Class: oxidoreductase
Keywords: DHFR, dihydrofolate reductase, dihydrofolate, complex, OXIDOREDUCTASE
Deposited on 2018-04-03, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
  Gene: folA, c0058
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ5 (0-158)
    • expression tag (159-164)
  Domains in SCOPe 2.07: d6cxka1, d6cxka2
• Heterogens: DHF, MG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6cxkA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerrhhhhhh