SCOPe 2.07: Structural Classification of Proteins

PDB entry 6cv6

View 6cv6 on RCSB PDB site
Description: Crystal structure of 3-dehydroquinate dehydratase, type II, from Burkholderia phymatum STM815
Class: lyase
Keywords: SSGCID, chorismate biosynthesis, 3-dehydroshikimate, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LYASE
Deposited on 2018-03-27, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6a_
Chain 'B':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
  - expression tag (18)
Domains in SCOPe 2.07: d6cv6b1, d6cv6b2
Chain 'C':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
  - expression tag (18)
Domains in SCOPe 2.07: d6cv6c1, d6cv6c2
Chain 'D':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6d_
Chain 'E':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
  - expression tag (18)
Domains in SCOPe 2.07: d6cv6e1, d6cv6e2
Chain 'F':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6f_
Chain 'G':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6g_
Chain 'H':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6h_
Chain 'I':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
  - expression tag (18)
Domains in SCOPe 2.07: d6cv6i1, d6cv6i2
Chain 'J':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6j_
Chain 'K':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6k_
Chain 'L':
Compound: 3-dehydroquinate dehydratase
Species: Paraburkholderia phymatum [TaxId:391038]
Gene: aroQ, Bphy_6025
Database cross-references and differences (RAF-indexed):
- Uniprot B2JVW0 (19-End)
Domains in SCOPe 2.07: d6cv6l_
Heterogens: TLA, TAR, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6cv6A (A:)
hhhhhhmgtleaqtqgpgsmkkvlmlhginhnmfgkrdpvqygtitlseidnrlqalaae
lgvqvesfqtnsegamcerihqafeercdavlinagawthysygirdalailtcpvvelh
msnvharepfrhhsvfsevvvgqicgfgmesyllalraavaqsgcs