PDB entry 6ct0

View 6ct0 on RCSB PDB site
Description: Atomic Structure of the E2 Inner Core of Human Pyruvate Dehydrogenase Complex
Class: oxidoreductase
Keywords: Pyruvate Dehydrogenase Complex, E2, Inner Core, OXIDOREDUCTASE
Deposited on 2018-03-21, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DLAT, DLTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ct00_

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >6ct00 (0:)
    mwrvcarraqnvapwaglearwtalqevpgtprvtsrsgpaparrnsvttgyggvralcg
    wtpssgatprnrlllqllgspgrryyslpphqkvplpslsptmqagtiarwekkegdkin
    egdliaevetdkatvgfesleecymakilvaegtrdvpigaiicitvgkpedieafknyt
    ldssaaptpqaapaptpaataspptpsaqapgssypphmqvllpalsptmtmgtvqrwek
    kvgeklsegdllaeietdkatigfevqeegylakilvpegtrdvplgtplciivekeadi
    safadyrptevtdlkpqvppptpppvaavpptpqplaptpsapcpatpagpkgrvfvspl
    akklavekgidltqvkgtgpdgritkkdidsfvpskvapapaavvpptgpgmapvptgvf
    tdipisnirrviaqrlmqskqtiphyylsidvnmgevllvrkelnkilegrskisvndfi
    ikasalaclkvpeansswmdtvirqnhvvdvsvavstpaglitpivfnahikgvetiand
    vvslatkaregklqphefqggtftisnlgmfgiknfsaiinppqacilaigasedklvpa
    dnekgfdvasmmsvtlscdhrvvdgavgaqwlaefrkylekpitmll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ct00 (0:)
    tgvftdipisnirrviaqrlmqskqtiphyylsidvnmgevllvrkelnkilegrskisv
    ndfiikasalaclkvpeansswmdtvirqnhvvdvsvavstplitpivfnahikgvetia
    ndvvslatkaregklqphefqggtftisnlgmfgiknfsaiinppqacilaigasedklv
    padnekgfdvasmmsvtlscdhrvvdgavgaqwlaefrkylekpitmll