Lineage for d6ct00_ (6ct0 0:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874761Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2874762Protein automated matches [190703] (7 species)
    not a true protein
  7. 2874804Species Human (Homo sapiens) [TaxId:9606] [351317] (2 PDB entries)
  8. 2874806Domain d6ct00_: 6ct0 0: [351318]
    automated match to d1c4tc_

Details for d6ct00_

PDB Entry: 6ct0 (more details), 3.1 Å

PDB Description: atomic structure of the e2 inner core of human pyruvate dehydrogenase complex
PDB Compounds: (0:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d6ct00_:

Sequence, based on SEQRES records: (download)

>d6ct00_ c.43.1.0 (0:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvftdipisnirrviaqrlmqskqtiphyylsidvnmgevllvrkelnkilegrskisv
ndfiikasalaclkvpeansswmdtvirqnhvvdvsvavstpaglitpivfnahikgvet
iandvvslatkaregklqphefqggtftisnlgmfgiknfsaiinppqacilaigasedk
lvpadnekgfdvasmmsvtlscdhrvvdgavgaqwlaefrkylekpitmll

Sequence, based on observed residues (ATOM records): (download)

>d6ct00_ c.43.1.0 (0:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvftdipisnirrviaqrlmqskqtiphyylsidvnmgevllvrkelnkilegrskisv
ndfiikasalaclkvpeansswmdtvirqnhvvdvsvavstplitpivfnahikgvetia
ndvvslatkaregklqphefqggtftisnlgmfgiknfsaiinppqacilaigasedklv
padnekgfdvasmmsvtlscdhrvvdgavgaqwlaefrkylekpitmll

SCOPe Domain Coordinates for d6ct00_:

Click to download the PDB-style file with coordinates for d6ct00_.
(The format of our PDB-style files is described here.)

Timeline for d6ct00_: