PDB entry 6cre

View 6cre on RCSB PDB site
Description: Dehaloperoxidase B in complex with 5-Br-ortho-guaiacol
Class: metal binding protein
Keywords: peroxidase, peroxygenase, substrate, METAL BINDING PROTEIN
Deposited on 2018-03-17, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6crea_
  • Chain 'B':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6creb_
  • Heterogens: HEM, SO4, F9G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6creA (A:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6creB (B:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk