PDB entry 6bpw

View 6bpw on RCSB PDB site
Description: Crystal structure of ferrous form of the Cl2-Tyr157 human cysteine dioxygenase with both uncrosslinked and crosslinked cofactor
Class: oxidoreductase
Keywords: Cysteine, Cys-Tyr cofactor, iron, unnatural amino acid, OXIDOREDUCTASE
Deposited on 2017-11-26, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cdo1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16878
      • conflict (136)
    Domains in SCOPe 2.08: d6bpwa_
  • Heterogens: 2LT, FE2, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6bpwA (A:)
    seqtevlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkk
    servlrenqcayindsvglhrvenishtepavslhlxsppfdtchafdqrtghknkvtmt
    fhskfgirtpnatsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpwA (A:)
    evlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkserv
    lrenqcayindsvglhrvenishtepavslhlxsppfdtchafdqrtghknkvtmtfhsk
    fgirtp