Lineage for d6bpwa_ (6bpw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815005Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2815006Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2815007Species Human (Homo sapiens) [TaxId:9606] [159290] (15 PDB entries)
    Uniprot Q16878 6-190
  8. 2815022Domain d6bpwa_: 6bpw A: [354391]
    automated match to d6bgfa_
    complexed with 2lt, fe2, gol, so4

Details for d6bpwa_

PDB Entry: 6bpw (more details), 2.43 Å

PDB Description: crystal structure of ferrous form of the cl2-tyr157 human cysteine dioxygenase with both uncrosslinked and crosslinked cofactor
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d6bpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bpwa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
evlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkserv
lrenqcayindsvglhrvenishtepavslhlxsppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d6bpwa_:

Click to download the PDB-style file with coordinates for d6bpwa_.
(The format of our PDB-style files is described here.)

Timeline for d6bpwa_: