PDB entry 6bab

View 6bab on RCSB PDB site
Description: The structure of human CamKII with bound inhibitor
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Kinase, CamKII, inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2017-10-12, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit delta
    Species: Mus musculus [TaxId:10090]
    Gene: Camk2d, Kiaa4163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6baba_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit delta
    Species: Mus musculus [TaxId:10090]
    Gene: Camk2d, Kiaa4163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6babb_
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit delta
    Species: Mus musculus [TaxId:10090]
    Gene: Camk2d, Kiaa4163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6babc_
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit delta
    Species: Mus musculus [TaxId:10090]
    Gene: Camk2d, Kiaa4163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d6babd_
  • Heterogens: D0S, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6babA (A:)
    ghmstttctrftdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqkle
    rearicrllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqq
    ilesvnhchlngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpg
    ylspevlrkdpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewd
    tvtpeakdlinkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrk
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6babA (A:)
    tdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkh
    pnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchln
    givhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdp
    ygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlin
    kmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6babB (B:)
    ghmstttctrftdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqkle
    rearicrllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqq
    ilesvnhchlngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpg
    ylspevlrkdpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewd
    tvtpeakdlinkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrk
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6babB (B:)
    eyqlfeelgsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkhpnivrl
    hdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngivhrd
    lkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpygkpvd
    mwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkmltin
    pakritasealkhpwicqrstvasmmhrqetvdclkkfnarrklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6babC (C:)
    ghmstttctrftdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqkle
    rearicrllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqq
    ilesvnhchlngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpg
    ylspevlrkdpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewd
    tvtpeakdlinkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrk
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6babC (C:)
    eyqlfeelgkgafsvvrrcmkqeyaakiintkklsardhqklerearicrllkhpnivrl
    hdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngivhrd
    lkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpygkpvd
    mwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkmltin
    pakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6babD (D:)
    ghmstttctrftdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqkle
    rearicrllkhpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqq
    ilesvnhchlngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpg
    ylspevlrkdpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewd
    tvtpeakdlinkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrk
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6babD (D:)
    rftdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrll
    khpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhch
    lngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrk
    dpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdl
    inkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl