PDB entry 6avd

View 6avd on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-09-01, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potassium channel toxin alpha-KTx 6.9
  Species: Opistophthalmus carinatus [TaxId:190115]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6XLL6 (2-39)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d6avda1, d6avda2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6avdA (A:)
  gsaeiircsgtrecyapcqkltgclnakcmnkackcygcv