PDB entry 6ava

View 6ava on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-09-01, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Insectotoxin-I1
  Species: Mesobuthus eupeus [TaxId:34648]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15220 (2-37)
    • expression tag (1)
  Domains in SCOPe 2.07: d6avaa1, d6avaa2
• Chain 'B':
  Compound: Insectotoxin-I1
  Species: Mesobuthus eupeus [TaxId:34648]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15220 (2-37)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d6avab1, d6avab2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6avaA (A:)
  gsmcmpcfttrpdmaqqcracckgrgkcfgpqclcgyd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6avaA (A:)
  smcmpcfttrpdmaqqcracckgrgkcfgpqclcgyd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6avaB (B:)
  gsmcmpcfttrpdmaqqcracckgrgkcfgpqclcgyd