PDB entry 6atn

View 6atn on RCSB PDB site
Description: Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Class: toxin
Keywords: Knottins, Cystine knot, Toxins, TOXIN
Deposited on 2017-08-29, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 4.5
    Species: Tityus costatus [TaxId:309814]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5G8B6 (2-38)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6atna1, d6atna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6atnA (A:)
    gsvfinvkcrgspeclpkckeaigksagkcmngkckcyp