PDB entry 6ash

View 6ash on RCSB PDB site
Description: Crystal stucture of human Cathepsin K with a non-active site inhibitor at 1.42 Angstrom resolution
Class: HYDROLASE/ HYDROLASE Inhibitor
Keywords: cathepsin K, exosite, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex, HYDROLASE, HYDROLASE- HYDROLASE Inhibitor complex
Deposited on 2017-08-24, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-214)
      • engineered mutation (48)
    Domains in SCOPe 2.07: d6asha_
  • Heterogens: 1XF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ashA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlapqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm