Lineage for d6asha_ (6ash A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. Protein (Pro)cathepsin K [54028] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. Domain d6asha_: 6ash A: [356665]
    automated match to d5tdia_
    complexed with 1xf

Details for d6asha_

PDB Entry: 6ash (more details), 1.42 Å

PDB Description: crystal structure of human cathepsin k with a non-active site inhibitor at 1.42 angstrom resolution
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d6asha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6asha_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlapqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d6asha_ are not available.

Timeline for d6asha_: