PDB entry 6al4

View 6al4 on RCSB PDB site
Description: crystal structure of anti-cd19 antibody b43 fab
Class: immune system
Keywords: immune system
Deposited on 2017-08-07, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: b43 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGK@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-107)
    • Uniprot Q6P5S8 (108-217)
    Domains in SCOPe 2.07: d6al4a1, d6al4a2
  • Chain 'B':
    Compound: b43 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-112)
    • Uniprot Q6GMX6 (113-226)
      • conflict (118)
  • Chain 'C':
    Compound: b43 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGK@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-107)
    • Uniprot Q6P5S8 (108-End)
    Domains in SCOPe 2.07: d6al4c1, d6al4c2
  • Chain 'D':
    Compound: b43 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-112)
    • Uniprot Q6GMX6 (113-End)
      • conflict (118)
  • Chain 'E':
    Compound: b43 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGK@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-107)
    • Uniprot Q6P5S8 (108-End)
    Domains in SCOPe 2.07: d6al4e1, d6al4e2
  • Chain 'F':
    Compound: b43 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • PDB 6AL4 (0-112)
    • Uniprot Q6GMX6 (113-End)
      • conflict (118)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6al4A (A:)
    diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
    gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6al4C (C:)
    diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
    gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6al4C (C:)
    diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
    gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6al4E (E:)
    diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
    gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6al4E (E:)
    diqltqspsflsasvgdrvtitckasqsvdysgdsylnwyqqkpgkapklliydasnlvs
    gvpsrfsgsgsgteftltisslqpedfatyycqqstenpwtfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    No sequence available.