SCOPe 2.08: Domain d6al4e2: 6al4 E:111-217

Lineage for d6al4e2 (6al4 E:111-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6al4e2: 6al4 E:111-217 [349997]
   Other proteins in same PDB: d6al4a1, d6al4b_, d6al4c1, d6al4d_, d6al4e1, d6al4f_
   automated match to d1dn0a2

Details for d6al4e2

PDB Entry: 6al4, 2.45 Å

PDB Description: crystal structure of anti-cd19 antibody b43 fab

PDB Compounds: (E:) b43 light chain

SCOPe Domain Sequences for d6al4e2:

Sequence; same for both SEQRES and ATOM records:

>d6al4e2 b.1.1.2 (E:111-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6al4e2:

• d6al4e2 first appeared in SCOPe 2.07