PDB entry 5zua

View 5zua on RCSB PDB site
Description: Crystal structure of MERS-CoV macro domain in complex with ATP
Class: viral protein
Keywords: Ligand, Complex, Macro domain, ATP, VIRAL PROTEIN
Deposited on 2018-05-07, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF1a
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed):
    • Uniprot T2B9G2 (4-167)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5zuaa1, d5zuaa2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5zuaA (A:)
gshmplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaask
gavqkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamna
yplvvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvykslti

    Sequence, based on observed residues (ATOM records): (download) 
    >5zuaA (A:)
hmplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskga
vqkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnayp
lvvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvykslti