PDB entry 5zqb

View 5zqb on RCSB PDB site
Description: Crystal Structure of Penicillin-Binding Protein D2 from Listeria monocytogenes in the Penicillin G bound form
Class: antibiotic
Keywords: Listeria monocytogenes, hypothetical, penicillin-binding protein, LmPBPD2, lmo2812, ANTIBIOTIC
Deposited on 2018-04-18, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqba_
  • Chain 'B':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqbb_
  • Chain 'C':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqbc_
  • Chain 'D':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqbd_
  • Heterogens: PNM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqbA (A:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqbA (A:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqbB (B:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqbB (B:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zqbC (C:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqbC (C:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zqbD (D:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqbD (D:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk