Lineage for d5zqbc_ (5zqb C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014846Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries)
  8. 3014862Domain d5zqbc_: 5zqb C: [355309]
    automated match to d5tr7b_
    complexed with gol, pnm

Details for d5zqbc_

PDB Entry: 5zqb (more details), 1.9 Å

PDB Description: crystal structure of penicillin-binding protein d2 from listeria monocytogenes in the penicillin g bound form
PDB Compounds: (C:) Lmo2812 protein

SCOPe Domain Sequences for d5zqbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqbc_ e.3.1.0 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
lmevgfk

SCOPe Domain Coordinates for d5zqbc_:

Click to download the PDB-style file with coordinates for d5zqbc_.
(The format of our PDB-style files is described here.)

Timeline for d5zqbc_: