PDB entry 5zj7

View 5zj7 on RCSB PDB site
Description: Crystal structure of NDM-1 in complex with D-captopril derivative CY22
Class: hydrolase
Keywords: NDM-1, metallo-beta-lactamase, antibiotic resistent, inhibitor, thio compounds, HYDROLASE
Deposited on 2018-03-19, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zj7a_
  • Heterogens: 9DU, EDO, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zj7A (A:)
    geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
    vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
    apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
    likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
    lr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj7A (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr