Lineage for d5zj7a_ (5zj7 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. Protein automated matches [190418] (31 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [189718] (102 PDB entries)
  8. Domain d5zj7a_: 5zj7 A: [366687]
    automated match to d5zh1b_
    complexed with 9du, edo, zn

Details for d5zj7a_

PDB Entry: 5zj7 (more details), 0.96 Å

PDB Description: crystal structure of ndm-1 in complex with d-captopril derivative cy22
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5zj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zj7a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5zj7a_ are not available.

Timeline for d5zj7a_: