PDB entry 5zis

View 5zis on RCSB PDB site
Description: Crystal structure of Mn-ProtoporphyrinIX-reconstituted P450BM3
Class: oxidoreductase
Keywords: Cytochrome P450, OXIDOREDUCTASE
Deposited on 2018-03-17, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512) [TaxId:1348623]
    Gene: cyp102A1, cyp102, BG04_163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zisa_
  • Chain 'B':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512) [TaxId:1348623]
    Gene: cyp102A1, cyp102, BG04_163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zisb_
  • Chain 'C':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512) [TaxId:1348623]
    Gene: cyp102A1, cyp102, BG04_163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zisc_
  • Chain 'D':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium (strain ATCC 14581 / DSM 32 / JCM 2506 / NBRC 15308 / NCIMB 9376 / NCTC 10342 / VKM B-512) [TaxId:1348623]
    Gene: cyp102A1, cyp102, BG04_163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zisd_
  • Heterogens: MNH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zisA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zisA (A:)
    empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
    esrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdia
    vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
    amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
    etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
    sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
    ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
    edhtnyeldiketltlkpegfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zisB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zisB (B:)
    pqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdes
    rfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavq
    lvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeam
    nklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpet
    geplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsy
    kqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdkt
    iwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfed
    htnyeldiketltlkpegfvvkakskkip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zisC (C:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zisC (C:)
    empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
    esrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdia
    vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
    amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
    etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
    sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
    ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
    edhtnyeldiketltlkpegfvvkakskkipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zisD (D:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zisD (D:)
    mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
    srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
    qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
    mnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpe
    tgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvps
    ykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdk
    tiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfe
    dhtnyeldiketltlkpegfvvkakskkipl