Lineage for d5zisa_ (5zis A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. Species Bacillus megaterium [TaxId:1348623] [342557] (8 PDB entries)
  8. Domain d5zisa_: 5zis A: [356184]
    automated match to d2x7ya_
    complexed with mnh

Details for d5zisa_

PDB Entry: 5zis (more details), 3.1 Å

PDB Description: crystal structure of mn-protoporphyrinix-reconstituted p450bm3
PDB Compounds: (A:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d5zisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zisa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1348623]}
empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
esrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdia
vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5zisa_ are not available.

Timeline for d5zisa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zisb_, d5zisc_, d5zisd_