PDB entry 5yir

View 5yir on RCSB PDB site
Description: Crystal Structure of AnkB LIR/GABARAP complex
Class: protein binding
Keywords: Autophagy, PROTEIN BINDING
Deposited on 2017-10-06, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Gamma-aminobutyric acid receptor-associated protein
  Species: Mus musculus [TaxId:10090]
  Gene: Gabarap
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DCD6 (0-116)
  Domains in SCOPe 2.07: d5yira_
• Chain 'B':
  Compound: Gamma-aminobutyric acid receptor-associated protein
  Species: Mus musculus [TaxId:10090]
  Gene: Gabarap
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DCD6 (0-116)
  Domains in SCOPe 2.07: d5yirb_
• Chain 'C':
  Compound: Ankyrin-2
  Species: Homo sapiens [TaxId:9606]
  Gene: ANK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01484
• Chain 'D':
  Compound: Gamma-aminobutyric acid receptor-associated protein
  Species: Mus musculus [TaxId:10090]
  Gene: Gabarap
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DCD6 (0-116)
  Domains in SCOPe 2.07: d5yird_
• Chain 'G':
  Compound: Ankyrin-2
  Species: Homo sapiens [TaxId:9606]
  Gene: ANK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01484
• Chain 'H':
  Compound: Ankyrin-2
  Species: Homo sapiens [TaxId:9606]
  Gene: ANK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01484
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yirA (A:)
  mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
  yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yirB (B:)
  mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
  yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yirD (D:)
  mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
  yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.