PDB entry 5y5o

View 5y5o on RCSB PDB site
Description: Crystal structure of the dUTPase of white spot syndrome virus in the apo state
Class: viral protein
Keywords: dUTPase, WSSV, pyrophosphatase, dUTP, VIRAL PROTEIN
Deposited on 2017-08-09, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5oa_
  • Chain 'B':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5ob_
  • Chain 'C':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5oc_
  • Chain 'D':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5od_
  • Chain 'E':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5oe_
  • Chain 'F':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y5of_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y5oA (A:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oA (A:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y5oB (B:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oB (B:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y5oC (C:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oC (C:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsssk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y5oD (D:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oD (D:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsssk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5y5oE (E:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oE (E:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5y5oF (F:)
    snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
    dkfpdgcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsia
    qliflrycdveeeqivyinettgertiidssskkdnknqarsvrgtggfgstdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y5oF (F:)
    ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
    gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
    rycdveeeqivyinettgertiidsssk