![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
![]() | Protein automated matches [191182] (16 species) not a true protein |
![]() | Species White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId:654913] [342590] (3 PDB entries) |
![]() | Domain d5y5od_: 5y5o D: [342602] automated match to d3c3ib_ |
PDB Entry: 5y5o (more details), 2.4 Å
SCOPe Domain Sequences for d5y5od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y5od_ b.85.4.0 (D:) automated matches {White spot syndrome virus (isolate shrimp/china/tongan/1996) [TaxId: 654913]} ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd gcygqivsrsgmtwknntsvptgtidvdyrgelkvilrnhsaeksvpirkgtsiaqlifl rycdveeeqivyinettgertiidsssk
Timeline for d5y5od_: