PDB entry 5xr2

View 5xr2 on RCSB PDB site
Description: sav0551
Class: chaperone
Keywords: Hsp31, chaperone, glyoxalase III
Deposited on 2017-06-07, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292)
    Domains in SCOPe 2.07: d5xr2a1, d5xr2a2
  • Chain 'B':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr2b_
  • Chain 'C':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292-299)
    Domains in SCOPe 2.07: d5xr2c1, d5xr2c2
  • Chain 'D':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr2d_
  • Chain 'E':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr2e_
  • Chain 'F':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr2f_
  • Chain 'G':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64312 (Start-291)
      • expression tag (292-299)
    Domains in SCOPe 2.07: d5xr2g1, d5xr2g2
  • Chain 'H':
    Compound: Protein/nucleic acid deglycase HchA
    Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) [TaxId:158878]
    Gene: hchA, SAV0551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xr2h_
  • Heterogens: LAC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xr2A (A:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2A (A:)
    elskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvl
    lengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynk
    lkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfi
    vtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkq
    glkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xr2B (B:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2B (B:)
    vnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeery
    vllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavisty
    nklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndr
    fivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadllt
    kqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xr2C (C:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2C (C:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xr2D (D:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2D (D:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnai
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xr2E (E:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2E (E:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xr2F (F:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2F (F:)
    lskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryvll
    engkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistynkl
    keklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrfiv
    tlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltkqg
    lkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xr2G (G:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2G (G:)
    nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
    llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
    klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
    ivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
    qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xr2H (H:)
    msqdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaa
    eeryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeav
    istynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwal
    dndrfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlva
    dlltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xr2H (H:)
    qdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaee
    ryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavis
    tynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldn
    drfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadl
    ltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqn