Lineage for d5xr2h_ (5xr2 H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859453Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. 2859471Domain d5xr2h_: 5xr2 H: [341080]
    Other proteins in same PDB: d5xr2a2, d5xr2c2, d5xr2g2
    automated match to d1izya_
    complexed with lac, zn

Details for d5xr2h_

PDB Entry: 5xr2 (more details), 2.6 Å

PDB Description: sav0551
PDB Compounds: (H:) Protein/nucleic acid deglycase HchA

SCOPe Domain Sequences for d5xr2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xr2h_ c.23.16.0 (H:) automated matches {Staphylococcus aureus [TaxId: 158878]}
qdvnelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaee
ryvllengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavis
tynklkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldn
drfivtlchgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadl
ltkqglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqn

SCOPe Domain Coordinates for d5xr2h_:

Click to download the PDB-style file with coordinates for d5xr2h_.
(The format of our PDB-style files is described here.)

Timeline for d5xr2h_: