PDB entry 5xpl

View 5xpl on RCSB PDB site
Description: Crystal structure of VDR-LBD complexed with 22S-butyl-25-hydroxyphenyl-2-methylidene-19,26,27-trinor-25-oxo-1-hydroxyvitamin D3
Class: transcription
Keywords: transcription, vitamin D3, VDR, VDRE, RXR, co-factors, SRC2-3, antagonist
Deposited on 2017-06-03, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xpla_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, BHLHE75, SRC2, TIF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 8C9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xplA (A:)
    gshmgspnsplkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgs
    vtldlsplsmlphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsn
    qsftmddmswdcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmai
    civspdrpgvqdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslnee
    hskqyrslsfqpensmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xplA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
    akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
    htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
    tyircrhpppgshqlyakmiqkladlrslneehskqyrslspensmkltplvlevfg
    

  • Chain 'C':
    No sequence available.