Lineage for d5xpla_ (5xpl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336128Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (25 PDB entries)
  8. 3053305Domain d5xpla_: 5xpl A: [353367]
    automated match to d1ie9a_
    complexed with 8c9

Details for d5xpla_

PDB Entry: 5xpl (more details), 2.05 Å

PDB Description: crystal structure of vdr-lbd complexed with 22s-butyl-25- hydroxyphenyl-2-methylidene-19,26,27-trinor-25-oxo-1-hydroxyvitamin d3
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5xpla_:

Sequence, based on SEQRES records: (download)

>d5xpla_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d5xpla_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmsplsmlphladlvsysiqkvigf
akmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskag
htlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlq
tyircrhpppgshqlyakmiqkladlrslneehskqyrslspensmkltplvlevfg

SCOPe Domain Coordinates for d5xpla_:

Click to download the PDB-style file with coordinates for d5xpla_.
(The format of our PDB-style files is described here.)

Timeline for d5xpla_:

  • d5xpla_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-07