PDB entry 5xc0

View 5xc0 on RCSB PDB site
Description: Crystal structure of an aromatic mutant (W6A) of an alkali thermostable GH10 Xylanase from Bacillus sp. NG-27
Class: hydrolase
Keywords: TIM barrel, xylanase, cryptic pocket, HYDROLASE
Deposited on 2017-03-21, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-xylanase
    Species: Bacillus sp. NG-27 [TaxId:65673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30700 (1-354)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d5xc0a_
  • Chain 'B':
    Compound: Beta-xylanase
    Species: Bacillus sp. NG-27 [TaxId:65673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30700 (1-354)
      • engineered mutation (6)
    Domains in SCOPe 2.08: d5xc0b_
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xc0A (A:)
    mvqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpe
    egvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqank
    elllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvaf
    etarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptid
    eirtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelye
    eldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xc0A (A:)
    vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
    gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
    lllerlethiktvverykddvtawdvvnevvddgtperglresvwyqitgdeyirvafet
    arkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptidei
    rtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyeel
    dadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xc0B (B:)
    mvqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpe
    egvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqank
    elllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvaf
    etarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptid
    eirtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelye
    eldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xc0B (B:)
    vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
    gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
    lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
    tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
    irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
    ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid