Lineage for d5xc0b_ (5xc0 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. Protein automated matches [190057] (28 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:65673] [187690] (11 PDB entries)
  8. Domain d5xc0b_: 5xc0 B: [348582]
    automated match to d5effa_
    complexed with mg, na; mutant

Details for d5xc0b_

PDB Entry: 5xc0 (more details), 2.32 Å

PDB Description: crystal structure of an aromatic mutant (w6a) of an alkali thermostable gh10 xylanase from bacillus sp. ng-27
PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5xc0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xc0b_ c.1.8.3 (B:) automated matches {Bacillus sp. [TaxId: 65673]}
vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

SCOPe Domain Coordinates for d5xc0b_ are not available.

Timeline for d5xc0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xc0a_