PDB entry 5wlu

View 5wlu on RCSB PDB site
Description: Carbonic Anhydrase IX-mimic in complex with aryloxy-2-hydroxypropylammine sulfonamide
Class: lyase/inhibitor
Keywords: carbonic anhydrase, beta adrenergic receptor, sulfonamide, aryloxy-2-hydroxypropylammine, LYASE, LYASE-INHIBITOR complex
Deposited on 2017-07-27, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Carbonic Anhydrase IX-mimic
  Species: Homo sapiens [TaxId:9606]
  Gene: CA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00918 (0-256)
    • conflict (61)
    • conflict (63)
    • conflict (65)
    • conflict (87)
    • conflict (126)
    • conflict (165)
    • conflict (199)
  Domains in SCOPe 2.07: d5wlua_
• Heterogens: 42G, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5wluA (A:)
  hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
  hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
  ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
  lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
  wrpaqplknrqikasfk