PDB entry 5wci

View 5wci on RCSB PDB site
Description: Human MYST histone acetyltransferase 1
Class: transferase
Keywords: MOF, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2017-06-30, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7Z6 (19-294)
      • expression tag (9-18)
      • conflict (94)
      • conflict (217)
    Domains in SCOPe 2.06: d5wcia1, d5wcia2
  • Heterogens: ZN, 1VU, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wciA (A:)
    mgsshhhhhhssglvprgstkvkyvdkihignyeidawyfspfpedygkqpklwlceycl
    kymkyeksyrfhlgqcqwrqppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhk
    tlyfdvepfvfyiltevdrqgahivgyfskekespdgnnvaciltlppyqrrgygkflia
    fsyelsklestvgspekplsdlgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqn
    diistlqslnmvkywkgqhvicvtpklveehlksaqykkppitvdsvclkwappk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wciA (A:)
    hssglvprgstkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksy
    rfhlgqcqwrqppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepf
    vfyiltevdrqgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelskle
    stvgspekplsdlgklsyrsywswvllenlrdfrglsikdlsqmtsitqndiistlqsln
    mvkywkgqhvicvtpklveehlksaqykppitvdsvclkwappk