PDB entry 5w9d

View 5w9d on RCSB PDB site
Description: Estrogen Receptor Alpha Ligand Binding Domain C381S, C417S, C530S Mutant in Complex with Endoxifen
Class: transcription
Keywords: Breast Cancer, Selective Estrogen Receptor Modulator, TRANSCRIPTION
Deposited on 2017-06-23, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • conflict (230)
    Domains in SCOPe 2.07: d5w9da_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • conflict (230)
    Domains in SCOPe 2.07: d5w9db_
  • Heterogens: 9XY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w9dA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w9dA (A:)
    alsltadqmvsalldaeppilyseydptrpeasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldahr
    lh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w9dB (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w9dB (B:)
    alsltadqmvsalldaeppilyseydptrpfssmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld