PDB entry 5w8i

View 5w8i on RCSB PDB site
Description: Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 23 and Zinc
Class: oxidoreductase
Keywords: oxidoreductase, oxidoreductase inhibitor
Deposited on 2017-06-21, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8ia1, d5w8ia2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8ib1, d5w8ib2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8ic1, d5w8ic2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8id1, d5w8id2
  • Heterogens: ZN, 9YD, CIT, DMS, MLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8iA (A:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8iA (A:)
    atlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevik
    lkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdl
    vkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w8iB (B:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8iB (B:)
    atlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevik
    lkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdl
    vkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w8iC (C:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8iC (C:)
    atlkdqliynllktpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
    lqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
    vkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpls
    chgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevikl
    kgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdlv
    kvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w8iD (D:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8iD (D:)
    atlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevik
    lkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdl
    vkvtltseeearlkksadtlwgiqkelqf