Lineage for d5w8id2 (5w8i D:160-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556875Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (29 PDB entries)
  8. 3048105Domain d5w8id2: 5w8i D:160-331 [348167]
    Other proteins in same PDB: d5w8ia1, d5w8ib1, d5w8ic1, d5w8id1
    automated match to d4jnka2
    complexed with 9yd, cit, dms, gol, mla, zn

Details for d5w8id2

PDB Entry: 5w8i (more details), 1.95 Å

PDB Description: crystal structure of lactate dehydrogenase a in complex with inhibitor compound 23 and zinc
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5w8id2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8id2 d.162.1.1 (D:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5w8id2:

Click to download the PDB-style file with coordinates for d5w8id2.
(The format of our PDB-style files is described here.)

Timeline for d5w8id2:

  • d5w8id2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06