PDB entry 5w0i

View 5w0i on RCSB PDB site
Description: CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-4-yl)-3,4-dihydroquinolin-1(2H)-yl)-1-(tetrahydrofuran-3-yl)-1,4,6,7-tetrahydro-5H-pyrazolo[4,3-c]pyridin-5-yl)ethan-1-one)
Class: transferase/inhibitor
Keywords: CREBBP, Bromodomain, small molecule inhibitor, TRANSFERASE-INHIBITOR complex
Deposited on 2017-05-30, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w0ia_
  • Heterogens: 9UA, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w0iA (A:)
    mhhhhhhgslvprgsmdykddddkenlyfqgskkifkpeelrqalmptlealyrqdpesl
    pfrqpvdpqllgipdyfdivknpmdlstikrkldtgqyqepwqyvddvwlmfnnawlynr
    ktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w0iA (A:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
    tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg